Query sequence: gi|34541714|ref|NP_906193.1| Accession: [none] Description: hypothetical protein PG2139 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF177 Uncharacterized ACR, COG1399 25.9 3.4e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF177 1/1 38 113 .. 53 137 .. 25.9 3.4e-07 Alignments of top-scoring domains: DUF177: domain 1 of 1, from 38 to 113: score 25.9, E = 3.4e-07 *->vsgevtLeCsRCLepveqpldveitelfveeeaeeddkeellPddae ++g+v +C+RCL +ve + e +++ d ++el gi|3454171 38 LDGTVKTACDRCLDEVEILVKEENKLVVRFG----DSYQELS----- 75 ddelvlvvedgeiDLeesVeDeilLalPmkplceeeck<-* dd lv ++ +g++DL+ ++++ La+Pm+ ++++ ++ gi|3454171 76 DDLLVVPLSEGTLDLSSLLYEYSELAIPMQRMHSDGEC 113