Query sequence: gi|34541477|ref|NP_905956.1| Accession: [none] Description: hypothetical protein PG1868 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- ICMT Isoprenylcysteine carboxyl methyltransferase 153.2 5.4e-43 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- ICMT 1/1 75 167 .. 1 99 [] 153.2 5.4e-43 Alignments of top-scoring domains: ICMT: domain 1 of 1, from 75 to 167: score 153.2, E = 5.4e-43 *->llglLmfllgqalRkwvmvtLGeiWthrviikKlpdHrlVtsGlYry + +l ++++a+++ v++ L + Wt +++i +pdHr+ ts+l+++ gi|3454147 75 VAIL---VFAYAMLFFVIYKLRDVWTLKLYI--VPDHRIETSFLFKT 116 lRHPNYfgnviwElatlpLLcnAwytalvffplnawvLfsvRIrqEEkaL +RHPNYf+nvi+El+++ LLcnAw+t +v+ p ++++Lf vRIrqEE+a+ gi|3454147 117 VRHPNYFLNVIPELIGITLLCNAWITFCVGMPVYLAILF-VRIRQEERAM 165 ae<-* + gi|3454147 166 KH 167