Query sequence: gi|34541454|ref|NP_905933.1| Accession: [none] Description: hypothetical protein PG1840 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Zn_peptidase Putative neutral zinc metallopeptidase 61.5 2.9e-21 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Zn_peptidase 1/1 2 33 .. 283 314 .] 61.5 2.9e-21 Alignments of top-scoring domains: Zn_peptidase: domain 1 of 1, from 2 to 33: score 61.5, E = 2.9e-21 *->VPDSFTHGTSaQRqrWFkRGfqSGdpaqCDTF<-* VPD F HGTS QR+ WFkRGf++Gd++ +DTF gi|3454145 2 VPDAFAHGTSSQRMYWFKRGFETGDFSAGDTF 33