Query sequence: gi|34541365|ref|NP_905844.1| Accession: [none] Description: hypothetical protein PG1738 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PAP2 PAP2 superfamily 29.0 1.2e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PAP2 1/1 256 328 .. 92 176 .] 29.0 1.2e-07 Alignments of top-scoring domains: PAP2: domain 1 of 1, from 256 to 328: score 29.0, E = 1.2e-07 *->SFPSGHaafaaaaalflalylprrlstlsrllrlllgllllllallv +FPS H ++ ++ f+ + +++ l + ll+++++ gi|3454136 256 AFPSSHVGITTVIFAFFHRSSRK------------LFWYLLPIGICL 290 glSRvylgvHypsDVlaGallGaliallvllfvrrlld<-* l++vy +Hy++DVlaG++ G l+ + ++ +l gi|3454136 291 TLATVYIQAHYFIDVLAGLVSGLLFYYGGNKLYSWLDI 328