Query sequence: gi|34541339|ref|NP_905818.1| Accession: [none] Description: hypothetical protein PG1707 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DivIC Septum formation initiator 14.0 0.0032 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DivIC 1/1 37 116 .. 1 82 [] 14.0 0.0032 Alignments of top-scoring domains: DivIC: domain 1 of 1, from 37 to 116: score 14.0, E = 0.0032 *->llllfqyllifgvggllayyqlnqeiaalqaelakLkaeneeLeaev + ++f++ ++fg+ +++ ++ ++ i+ l++el ++k++ ++ + gi|3454133 37 IGFFFLVTFVFGDANISKQIRYKSRINNLKKELREVKERYHQDSVRL 83 kdLknsLdpdyIeeqARseLGlvkpgEtvyrvvek<-* ++ + ++ Ie AR+ + + +p E+++ + ++ gi|3454133 84 EEIRA--NKQGIEHTARELYLMKRPEEIIFLIKDS 116