Query sequence: gi|34541296|ref|NP_905775.1| Accession: [none] Description: hypothetical protein PG1655 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF1661 Protein of unknown function (DUF1661) 64.1 7.9e-19 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF1661 1/1 35 68 .. 1 34 [] 64.1 7.9e-19 Alignments of top-scoring domains: DUF1661: domain 1 of 1, from 35 to 68: score 64.1, E = 7.9e-19 *->LvRevknsRAKTKKFSrhvfvgnRkyepqsgdFR<-* L+++++n+RAKTKKFSrhvfvgn++ + ++++R gi|3454129 35 LACKFFNCRAKTKKFSRHVFVGNKCENSGTQTYR 68