Query sequence: gi|34541232|ref|NP_905711.1| Accession: [none] Description: hypothetical protein PG1580 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF58 Protein of unknown function DUF58 43.7 7.1e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF58 1/1 34 74 .. 63 103 .] 43.7 7.1e-11 Alignments of top-scoring domains: DUF58: domain 1 of 1, from 34 to 74: score 43.7, E = 7.1e-11 *->ggegtefhglReYvpGDdlRrIdWKasARrGkLlvrEfepe<-* +g g f ++ReY GDd+R IdW ++AR+ +++v+ fe+e gi|3454123 34 RGRGMAFSEVREYTVGDDVRDIDWNVTARYARPYVKVFEEE 74