Query sequence: gi|34541173|ref|NP_905652.1| Accession: [none] Description: hypothetical protein PG1508 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF1672 Protein of unknown function (DUF1672) 8.7 0.015 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF1672 1/1 1 31 [. 1 31 [. 8.7 0.015 Alignments of top-scoring domains: DUF1672: domain 1 of 1, from 1 to 31: score 8.7, E = 0.015 *->MfKriklIliaTllLsgCSTtnnEsnnetkS<-* M+K+ + + ++ gCS t nE e kS gi|3454117 1 MMKKMYVFILCLIVFAGCSQTDNEPVTEGKS 31