Query sequence: gi|34541138|ref|NP_905617.1| Accession: [none] Description: hypothetical protein PG1471 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF304 Bacterial membrane flanked domain 19.4 0.00011 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF304 1/1 67 146 .. 1 87 [] 19.4 0.00011 Alignments of top-scoring domains: DUF304: domain 1 of 1, from 67 to 146: score 19.4, E = 0.00011 *->kyrntgyGaieddrlhvryGllsrrrviiplkrIqsvtlrqgplqRl + r ++y +++ r++++ Gl++r+ v++ l++ ++ + ++++ R+ gi|3454113 67 GRRYAEY-VVTNKRVIFKLGLIRRSVVELQLNKAEAIAFGESFWGRI 112 fGlatvvietaggGssssgssiellpivnkeeaeallrnl<-* f+ +tvv++t + +++ + + + +a+ +++ gi|3454113 113 FNFGTVVVTTG------GATNTYHYIADPLSFRRAISEEV 146