Query sequence: gi|34541121|ref|NP_905600.1| Accession: [none] Description: hypothetical protein PG1450 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF24 Transcriptional regulator 106.7 1.2e-33 1 PadR Transcriptional regulator PadR-like family 9.7 0.025 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF24 1/1 18 104 .] 1 88 [. 106.7 1.2e-33 PadR 1/1 57 93 .. 50 89 .] 9.7 0.025 Alignments of top-scoring domains: DUF24: domain 1 of 1, from 18 to 104: score 106.7, E = 1.2e-33 *->liGgKWklLILreLldEGpkRFsELkralPgIsqKmLtqrLReLEqd + gKW+lLI+++ + R++ELkra+PgIs+KmL++ L+ L gi|3454112 18 IFAGKWTLLIIFQINR-RIIRYGELKRAIPGISEKMLIDELKFLCGK 63 GiinRevYpevPpkVEYSLTekGrsLePilqalckWGeeyl<-* G+i+ + YpevPp+VEYSLT++G+ + Pi+++++k G+e+l gi|3454112 64 GLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIAKFGMENL 104 PadR: domain 1 of 1, from 57 to 93: score 9.7, E = 0.025 *->LkrLEkeGLveseweesdggGppRKyYrLTdaGrreLaer<-* Lk L +GL+++ + + + ppR Y LT+ G+++L + gi|3454112 57 LKFLCGKGLIKKKQYP---EVPPRVEYSLTPLGEKVLPII 93