Query sequence: gi|34541112|ref|NP_905591.1| Accession: [none] Description: hypothetical protein PG1439 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Pox_VLTF3 Poxvirus Late Transcription Factor VLTF3 li 7.9 0.05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Pox_VLTF3 1/1 546 579 .. 55 88 .. 7.9 0.05 Alignments of top-scoring domains: Pox_VLTF3: domain 1 of 1, from 546 to 579: score 7.9, E = 0.05 *->LRrllsnqisgdiieEllelmakNnLstkdidan<-* +++l+s is i+++le++ N L + i++n gi|3454111 546 MKKLSSYKISRSQIQGFLEIIGYNDLDYAIITTN 579