Query sequence: gi|34541049|ref|NP_905528.1| Accession: [none] Description: hypothetical protein PG1363 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CtnDOT_TraJ Homologues of TraJ from Bacteroides conju 126.3 4.6e-36 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CtnDOT_TraJ 1/1 10 84 .. 1 74 [] 126.3 4.6e-36 Alignments of top-scoring domains: CtnDOT_TraJ: domain 1 of 1, from 10 to 84: score 126.3, E = 4.6e-36 *->FmlIGIiGYFtvPTVSgWIIQAGGaiGnYgrnvNsaakkaGgkagaa F+lIGI+G ++vPTV+gWII+AGG+iG+Y rnvN++a+++ ++a+++ gi|3454104 10 FLLIGIVGCYCVPTVAGWIIGAGGGIGSYERNVNQTAQRGTQGAYTG 56 akalvgGAvvllpvm.fdGnaaGrirgk<-* +ka+ gGA+vllpvm+fd++++ i+g gi|3454104 57 SKAMGGGAQVLLPVMsFDVSKGALIKGE 84