Query sequence: gi|34541034|ref|NP_905513.1| Accession: [none] Description: hypothetical protein PG1347 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- GTP_cyclohydroI GTP cyclohydrolase I 187.5 2.8e-53 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- GTP_cyclohydroI 1/1 41 140 .. 1 105 [] 187.5 2.8e-53 Alignments of top-scoring domains: GTP_cyclohydroI: domain 1 of 1, from 41 to 140: score 187.5, E = 2.8e-53 *->emVkvtdieftslCPhhgvPDfgkvhIaYiPddkvvELksLklyves + V+++++eftslCP +g+PDf++++I YiPd k+vE+ksLkly++s gi|3454103 41 YWVRFNCPEFTSLCPITGQPDFATIYINYIPDVKMVESKSLKLYLFS 87 FrnrgqvQErltnqIaeaLvelLkPrgvaVvgeanHmCmvmRGgiktgve Frn+g ++E++ n I+ +L++l++Pr+++V+g++++ RGgi+++++ gi|3454103 88 FRNHGAFHEDCVNIIMKDLIALMQPRYIEVWGDFTP-----RGGISIVPF 132 tetsaagg<-* ++++++g+ gi|3454103 133 CNYGKPGS 140