Query sequence: gi|34541029|ref|NP_905508.1| Accession: [none] Description: hypothetical protein PG1341 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SPOR Sporulation related repeat 28.7 5e-07 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SPOR 1/2 105 140 .. 1 36 [] 22.6 2.5e-05 SPOR 2/2 142 177 .. 1 36 [] 6.1 1 Alignments of top-scoring domains: SPOR: domain 1 of 2, from 105 to 140: score 22.6, E = 2.5e-05 *->ngglyrVQvGafssrenAerlqakLkaaGysavvis<-* ++ V+vG+f+++ nA++l+++L + Gy ++ gi|3454102 105 RLDRFSVVVGSFRNATNARSLKERLESEGYTPILAE 140 SPOR: domain 2 of 2, from 142 to 177: score 6.1, E = 1 *->ngglyrVQvGafssrenAerlqakLkaaGysavvis<-* g rV v++f sre+A ++++ +k ++ + + gi|3454102 142 EQGMLRVIVASFPSREEAIAAREAVKERYAPNFQDA 177