Query sequence: gi|34540995|ref|NP_905474.1| Accession: [none] Description: hypothetical protein PG1300 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Cons_hypoth95 Conserved hypothetical protein 95 153.5 8.3e-44 1 N6_N4_Mtase DNA methylase 6.6 0.064 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Cons_hypoth95 1/1 1 179 [] 1 190 [] 153.5 8.3e-44 N6_N4_Mtase 1/1 115 126 .. 1 12 [. 6.6 0.064 Alignments of top-scoring domains: Cons_hypoth95: domain 1 of 1, from 1 to 179: score 153.5, E = 8.3e-44 *->mRIigGkykGRkLkvpsgpgtRPTtDrVREalFNilapyielggarv mR+i Gky++R+ vp++ + RPTtD +E lFNil ++++ +g gi|3454099 1 MRVIRGKYGHRRFDVPKSFNARPTTDFAKENLFNILSNRFDFEGLSA 47 LDLFAGSGaLGlEALSRGAskvvfVEkdkkavailkeNleaLglngSKee +DLF+G+G+++lE +SRG+s+v+ +Ek ++ +a ++ +++L+ ee gi|3454099 48 IDLFSGTGSIALELVSRGCSSVTSIEKRREHAAFIRNLIKHLN-----EE 92 eetavlrmdaarallrlakkgppFDiVFLDPPYakglalieealellaen + ++v+ d++++l+r+ k +D+VF+DPPYa ++ e++ +++e+ gi|3454099 93 NCWRVFETDVFLFLERN-KVCHRYDLVFADPPYALTEL--EQLPTKVLES 139 gwLkpnalivvEtesdeelpeqpanlelvreKkyGqtklafyk<-* ++L++++l ++E+++d + e+p +e +r yG++ ++f++ gi|3454099 140 NILAEDGLFILEHPKDFSFTEHPR-FEEHRA--YGSVNFTFFR 179 N6_N4_Mtase: domain 1 of 1, from 115 to 126: score 6.6, E = 0.064 *->vdlivtDPPYnl<-* dl+++DPPY l gi|3454099 115 YDLVFADPPYAL 126