Query sequence: gi|34540832|ref|NP_905311.1| Accession: [none] Description: hypothetical protein PG1099 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SIS SIS domain 30.1 1e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SIS 1/1 126 205 .. 58 150 .] 30.1 1e-07 Alignments of top-scoring domains: SIS: domain 1 of 1, from 126 to 205: score 30.1, E = 1e-07 *->idpdDlviaiSfsGetadlveaaeelakrrgapiiiaitdsklegSp + D vi i+ sG t++++ a++ a+r+g+ + +i+ + +Sp gi|3454083 126 VNSSDTVIGIAASGTTPYVIGALR-EARRHGIL-TGCICSNI--ESP 168 lareadhtlyvpaeeealvkflsnas..tsattlqltalivlalagad<- la ead+ ++v +++e +s+++++ t+q ++l++ + gi|3454083 169 LAAEADCPIEVIVGPEYVT-----GSsrMKSGTAQKMILNM------I 205 * gi|3454083 - -