Query sequence: gi|34540796|ref|NP_905275.1| Accession: [none] Description: hypothetical protein PG1059 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CtnDOT_TraJ Homologues of TraJ from Bacteroides conju 136.0 7e-39 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CtnDOT_TraJ 1/1 10 84 .. 1 74 [] 136.0 7e-39 Alignments of top-scoring domains: CtnDOT_TraJ: domain 1 of 1, from 10 to 84: score 136.0, E = 7e-39 *->FmlIGIiGYFtvPTVSgWIIQAGGaiGnYgrnvNsaakkaGgkagaa F+lIGI+GY++vP V+gWII+AGG+iG+YgrnvN+++++++++a+++ gi|3454079 10 FLLIGIAGYYCVPKVAGWIIGAGGGIGSYGRNVNQTVQRGAQGAYTG 56 akalvgGAvvllpvm.fdGnaaGrirgk<-* +ka+vg+A+vllpvm+f ++++++++ + gi|3454079 57 SKAMVGEAQVLLPVMsFGVSKGHSLKRR 84