Query sequence: gi|34540679|ref|NP_905158.1| Accession: [none] Description: hypothetical protein PG0922 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- FtsX Predicted permease 88.7 1.5e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- FtsX 1/1 227 404 .. 1 167 [] 88.7 1.5e-24 Alignments of top-scoring domains: FtsX: domain 1 of 1, from 227 to 404: score 88.7, E = 1.5e-24 *->vtaivvkakdpanvdalakklekl...........eile.lfsalss + a+++++ + +++++a +l+++ +++ + + + +++ + + gi|3454067 227 AEAVAIQLRTGSDAEQIALRLKETlgdsyqvldlaGQHPeITHLIAM 273 iktllgliamvisllvaalgigntllmsvteRtrEIgiLrAlGAsrrqIl +k++ +li+ +++l++a+++i+++l+m+ +e++ +I +L ++GA+ + I gi|3454067 274 EKWMSYLIL-LFILVLATFNIVSSLSMLLIEKKEDIYTLHSMGATSQTIS 322 riFllEglllgllGgllGlllGllanltliflayll......llalsyfl riF +Egll++ G+++G+l+G++ l l ++ + l ++ gi|3454067 323 RIFRIEGLLVSMTGAAIGILIGIG-------LCVLQqqygliTLQMGLGS 365 stlplslsp.avllalllalligllagllParrAarldP<-* ++ p+ ++ +++ ++l + ++ la+++P+ + + gi|3454067 366 VAYPVRMDVaDLVVIFLTIFTLSYLAAYYPVHYFINRRL 404