Query sequence: gi|34540629|ref|NP_905108.1| Accession: [none] Description: hypothetical protein PG0859 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HipA_C HipA-like C-terminal domain 126.7 2.4e-39 1 HipA_N HipA-like N-terminal domain 116.7 5.1e-39 1 DUF305 Domain of unknown function (DUF305) 10.3 0.031 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF305 1/1 40 55 .. 31 46 .. 10.3 0.031 HipA_N 1/1 56 139 .. 1 107 [] 116.7 5.1e-39 HipA_C 1/1 145 225 .. 1 89 [] 126.7 2.4e-39 Alignments of top-scoring domains: DUF305: domain 1 of 1, from 40 to 55: score 10.3, E = 0.031 *->spevrkLAldIiasQs<-* s+evr+LA+++++sQ+ gi|3454062 40 SSEVRALADEVVRSQT 55 HipA_N: domain 1 of 1, from 56 to 139: score 116.7, E = 5.1e-39 *->SagGvQpKlslrlndgsGlasptsqvgstngdrhyIvKfpieqvrra ++ GvQpKlsl+++++s + +++++++ +g+ +I+K++ gi|3454062 56 TVTGVQPKLSLDFDQMS-NSPKRFTIVGLWGR--FILKPQ------- 92 nssdysnlvenEflinrcwamqlakkeaaGIevaetglvqfsevrayPsy +++ys+l+e+E + m+la+ a+Ie++++gl++fs+++++ gi|3454062 93 -TERYSHLPELEDV-----SMHLAE--IAKIETVPHGLMRFSDGELC--- 131 dAlvvkRFDR<-* ++++R+DR gi|3454062 132 --YITRRIDR 139 HipA_C: domain 1 of 1, from 145 to 225: score 126.7, E = 2.4e-39 *->RlhqEDfcqalglpprdKYessgGpgrdvyediadllraqrserpaa +l++ED+cq+ +++KY++s +e+ a+l++ ++s+ p + gi|3454062 145 KLPMEDMCQLSERLTEYKYKGS-------HEQVAKLIS-KYSSVPKL 183 dleelfrrlvFnwLigNtDdHlKNfSllyddgggwrLaPaYD<-* dl++++ +++F+wLigN+D+HlKN+Sl ++g++++L+PaYD gi|3454062 184 DLVKYWEQVLFSWLIGNADMHLKNYSLYAPEGNEYQLTPAYD 225