Query sequence: gi|34540427|ref|NP_904906.1| Accession: [none] Description: hypothetical protein PG0621 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF1599 Domain of Unknown Function (DUF1599) 294.4 4.1e-88 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF1599 1/2 26 86 .. 1 62 [] 147.8 5.5e-44 DUF1599 2/2 119 180 .. 1 62 [] 146.6 1.2e-43 Alignments of top-scoring domains: DUF1599: domain 1 of 2, from 26 to 86: score 147.8, E = 5.5e-44 *->klHDYgaaWRilRpssltDqlfiKakRireiedlkgeslVsEGidae klHDYga+WR++RpssltDql+iKa+Rir+i+ +kg s+V+EG+++e gi|3454042 26 KLHDYGASWRVMRPSSLTDQLYIKANRIRNIQ-MKGLSKVDEGVESE 71 fialiNYgiigLIqL<-* fi+++NYg+i+LIqL gi|3454042 72 FIGVVNYGVIALIQL 86 DUF1599: domain 2 of 2, from 119 to 180: score 146.6, E = 1.2e-43 *->klHDYgaaWRilRpssltDqlfiKakRireiedlkgeslVsEGidae k+HDYg+aWR++R+ss++D++++K++R++eiedl+g++++sEG+da+ gi|3454042 119 KNHDYGEAWRQMRVSSFADLILTKVFRTKEIEDLGGDTYISEGVDAN 165 fialiNYgiigLIqL<-* ++++iNY+i++LIqL gi|3454042 166 YMDMINYAIFALIQL 180