Query sequence: gi|34540329|ref|NP_904808.1| Accession: [none] Description: conserved hypothetical protein TIGR00255 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- YicC_N YicC-like family, N-terminal region 38.8 2.3e-11 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- YicC_N 1/2 2 63 .. 1 62 [. 16.1 0.00013 YicC_N 2/2 112 163 .. 108 161 .] 22.7 1.4e-06 Alignments of top-scoring domains: YicC_N: domain 1 of 2, from 2 to 63: score 16.1, E = 0.00013 *->IrSMTGFAraEkeggwgsaavElRSVNhRfLEvnfRLPeqLrgLEpe I SMTGF++ + +++++ ++S+N++ ++++ + r+ E+ gi|3454032 2 ILSMTGFGKHTIQFADKKITATIKSLNSKQFDLSTKISSRYRDRELP 48 lRerirqrlsRGKve<-* lR ++++ + RGKv+ gi|3454032 49 LRALVSADIGRGKVD 63 YicC_N: domain 2 of 2, from 112 to 163: score 22.7, E = 1.4e-06 *->dlLrlpGVleaqeeeeddeEaRAel....eaailaaleeALddLiaa +lLr+pGV++++ e+ +e e++++++a++++ + ALd+Li gi|3454032 112 QLLRIPGVIQID--EDKEE----EIpedeWAVVIETCRRALDQLIGF 152 RekEGakLkad<-* Re EGa L + gi|3454032 153 REQEGAMLEQV 163