Query sequence: gi|34540227|ref|NP_904706.1| Accession: [none] Description: hypothetical protein PG0400 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PSP1 PSP1 C-terminal conserved region 91.2 3.6e-27 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PSP1 1/1 62 149 .. 1 97 [] 91.2 3.6e-27 Alignments of top-scoring domains: PSP1: domain 1 of 1, from 62 to 149: score 91.2, E = 3.6e-27 *->plksViRvADtpeDletwLeknkeeaeaAleicrqkikehgLpMKlv ++ ++ R+A +Dl+++ + k ++ ++ + rq+ +e++L+MK+ gi|3454022 62 EPFKIYRIA-KQGDLDKY-CEAKAREYDTMIQSRQISAELNLDMKIG 106 dveYtFDrkkvtFYYtAeeRvDGTSGHPNFReLVrdLakvFktRIeLrqI dveY+ D +k +FYY A+eRvD FR L+r La +F++R+e++qI gi|3454022 107 DVEYQGDGNKAIFYYIADERVD-------FRQLIRVLAETFHIRVEMKQI 149 <-* gi|3454022 - -