Query sequence: gi|34540156|ref|NP_904635.1|
Accession:      [none]
Description:    hypothetical protein PG0320 [Porphyromonas gingivalis W83]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
DUF1573  Protein of unknown function (DUF1573)          105.6    1.2e-31   2

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
DUF1573    1/2      50    95 ..     1    46 []    98.0  2.5e-29
DUF1573    2/2     283   299 ..     4    20 ..     7.6     0.13

Alignments of top-scoring domains:
DUF1573: domain 1 of 2, from 50 to 95: score 98.0, E = 2.5e-29
                   *->hrFeitNtGdaPLvitrVrtsCGCTvptveketIaPGetgsikatf<
                      h+F+++N+G+aPL+itrV+++CGCT+pt+++e+IaPGe+++i++ f 
  gi|3454015    50    HSFKFRNSGTAPLLITRVMADCGCTTPTWPEEAIAPGEEAEIRVLF  95   

                   -*
                     
  gi|3454015     -    -    

DUF1573: domain 2 of 2, from 283 to 299: score 7.6, E = 0.13
                   *->eitNtGdaPLvitrVrt<-*
                      ei+N+G++PL +++V+t   
  gi|3454015   283    EIRNVGAGPLRLHSVTT    299