Query sequence: gi|34540155|ref|NP_904634.1| Accession: [none] Description: hypothetical protein PG0319 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF1573 Protein of unknown function (DUF1573) 105.7 1.1e-31 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF1573 1/1 64 109 .. 1 46 [] 105.7 1.1e-31 Alignments of top-scoring domains: DUF1573: domain 1 of 1, from 64 to 109: score 105.7, E = 1.1e-31 *->hrFeitNtGdaPLvitrVrtsCGCTvptveketIaPGetgsikatf< h+F+i+NtGdaPLvitrV++sCGCT+p+++ke+IaPG+t++i++t+ gi|3454015 64 HTFVIKNTGDAPLVITRVVASCGCTTPQFSKEPIAPGQTSKIDVTY 109 -* gi|3454015 - -