Query sequence: gi|34539992|ref|NP_904471.1| Accession: [none] Description: hypothetical protein PG0128 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Kdo Lipopolysaccharide kinase (Kdo/WaaP) family 41.6 2.1e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Kdo 1/1 90 187 .. 71 177 .. 41.6 2.1e-11 Alignments of top-scoring domains: Kdo: domain 1 of 1, from 90 to 187: score 41.6, E = 2.1e-11 *->rLreaGvpVPkpvAagavkvgleryqAdLLtEklegaqDLvtwlaqW rL + G+ +P+p +++++++++ ++ + E + +D+ + gi|3453999 90 RLGRCGIGTPRPSGYAIEREKGLLCRSYYVCESMHDCRDIRLSMQG- 135 addPpaeelrqalweavGrlIakmHragvnHtDLnahnILldqeesvegk +e +al++a + Ia+mHrag+ H DL + n+L +++e +g+ gi|3453999 136 ------VEGGEALLRALAGFIARMHRAGIHHIDLSPGNVLYRTDE--KGE 177 fkvwlIDfdK<-* ++lID+ + gi|3453999 178 YSFYLIDLNR 187