Query sequence: gi|34539927|ref|NP_904406.1| Accession: [none] Description: hypothetical protein PG0055 [Porphyromonas gingivalis W83] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PspC PspC domain 36.6 2.2e-09 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PspC 1/1 122 186 .. 1 65 [] 36.6 2.2e-09 Alignments of top-scoring domains: PspC: domain 1 of 1, from 122 to 186: score 36.6, E = 2.2e-09 *->mrkLyRsrdnRmiaGVcAGLAeYFglDvtlVRvlfvllllltFGsfG +rk+yR+ d +++GVc G+A Y + v +Rv++vl ++l+ +f gi|3453992 122 KRKFYRDMDHAVLCGVCSGIAAYTRWNVNAIRVIVVLMTILASPLFW 168 lglllYiilaiilPpeed<-* ++ Y++ + i Pp+ + gi|3453992 169 MIIIGYLAVWMIAPPAIT 186