Query sequence: gi|24380483|ref|NP_722438.1| Accession: [none] Description: hypothetical protein SMU.2155 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- S4 S4 domain 14.9 0.0034 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- S4 1/1 10 57 .. 1 48 [] 14.9 0.0034 Alignments of top-scoring domains: S4: domain 1 of 1, from 10 to 57: score 14.9, E = 0.0034 *->mRLDkvLarlglasSRseArqlIrhGhVkVNGkvvkdpsyrvkpgDv L+ +L++lg+ +S +++ + + V+ NG++ ++ + +++ gD+ gi|2438048 10 ITLQALLKNLGVIPSGGAIKSYLANTEVLFNGQPETRRGKKLRLGDQ 56 i<-* i gi|2438048 57 I 57