Query sequence: gi|24380467|ref|NP_722422.1| Accession: [none] Description: hypothetical protein SMU.2137c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF1021 Protein of unknown function (DUF1021) 155.4 7.7e-46 1 Hanta_nucleocap Hantavirus nucleocapsid protein 6.2 0.037 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Hanta_nucleocap 1/1 8 26 .. 1 19 [. 6.2 0.037 DUF1021 1/1 11 90 .] 1 80 [] 155.4 7.7e-46 Alignments of top-scoring domains: Hanta_nucleocap: domain 1 of 1, from 8 to 26: score 6.2, E = 0.037 *->msnlkElqeeitaHEqqLv<-* ++++k ++e+i aHE+q v gi|2438046 8 VAKMKKIKEDIKAHEGQKV 26 DUF1021: domain 1 of 1, from 11 to 90: score 155.4, E = 7.7e-46 *->lkdIKesieahvGerveLkanGGRKKtiersGiLeetYPSvFIVeld +k+IKe+i+ah+G++veL++++GRK++++++G+L+e+Y+S+FIVe++ gi|2438046 11 MKKIKEDIKAHEGQKVELTLENGRKREKNKIGRLIEVYSSLFIVEYK 57 qdegdktvinnferVSYsYsDILTetveltfld<-* ++++++++i+n++++SY+YsDILTe+++++++d gi|2438046 58 DKASVPGEIDNTYVESYTYSDILTEKTLIRYFD 90