Query sequence: gi|24380456|ref|NP_722411.1| Accession: [none] Description: hypothetical protein SMU.2125 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF24 Transcriptional regulator 58.5 2.6e-18 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF24 1/1 7 94 .] 1 88 [. 58.5 2.6e-18 Alignments of top-scoring domains: DUF24: domain 1 of 1, from 7 to 94: score 58.5, E = 2.6e-18 *->liGgKWklLILreLldEGpkRFsELkralPgIsqKmLtqrLReLEqd ++GgKW l +L++ + + RF++Lkr gI++ mLt++L L ++ gi|2438045 7 VVGGKWRLNVLWVINKYQSIRFNQLKREVNGITTIMLTRSLDILITN 53 GiinRevYpevPpkVEYSLTekGrsLePilqalckWGeeyl<-* ++++ + + P +V Y L+ kG+sL+P l+++ +WG+ yl gi|2438045 54 ELVEKVDFQTLPLHVKYQLSSKGKSLMPLLKQINQWGKLYL 94