Query sequence: gi|24380433|ref|NP_722388.1| Accession: [none] Description: hypothetical protein SMU.2100c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF161 Uncharacterized BCR, YitT family COG1284 160.7 3.2e-45 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF161 1/2 38 126 .. 1 84 [] 65.6 1.8e-17 DUF161 2/2 138 219 .. 1 84 [] 95.1 1.3e-25 Alignments of top-scoring domains: DUF161: domain 1 of 2, from 38 to 126: score 65.6, E = 1.8e-17 *->kllaaliGglllglGlglflipnglstGGtdglalilsklfg..... ++ ++i++ll+++++++f++p++++++G++gla+i+s l+ + + gi|2438043 38 RISGSIIYALLSSIAVNFFFQPGNVYASGATGLAQIVSTLSVkyfgl 84 .isvGlilfliNipllilayfflgklrfalyTliavfvlsifi<-* +i+v++++ +iNiplli+a+ +g+ +f+++T+i+v ++s+fi gi|2438043 85 tIPVSVTFYAINIPLLIIAWYMIGH-KFTVFTFITVTLSSLFI 126 DUF161: domain 2 of 2, from 138 to 219: score 95.1, E = 1.3e-25 *->kllaaliGglllglGlglflipnglstGGtdglalilsklfgisvGl ++++a++Ggl++g G+g+ ++n++s+GGtd+++l++ k++g vG+ gi|2438043 138 PMINAIFGGLVMGTGIGFA-LRNNVSSGGTDIISLLVRKKTGRKVGT 183 ilfliNipllilayfflgklrfalyTliavfvlsifi<-* +++++Ni ++i+a+ +g ++ aly+ +++fv+s ++ gi|2438043 184 VSLIVNILIMIIAGMTFG-WQYALYSMVTIFVSSQMT 219