Query sequence: gi|24380430|ref|NP_722385.1|
Accession:      [none]
Description:    hypothetical protein SMU.2097 [Streptococcus mutans UA159]

Scores for sequence family classification (score includes all domains):
Model           Description                             Score    E-value  N 
--------        -----------                             -----    ------- ---
Arg_repressor_C Arginine repressor, C-terminal domain    86.9      5e-24   1

Parsed for domains:
Model           Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------        ------- ----- -----    ----- -----      -----  -------
Arg_repressor_C   1/1       1    69 [.     1    71 []    86.9    5e-24

Alignments of top-scoring domains:
Arg_repressor_C: domain 1 of 1, from 1 to 69: score 86.9, E = 5e-24
                   *->llsdlvvsvehvenlvVirTlPGnAsllAsliDelgldeGIlGTiAG
                       ++d++v+++ v+n+v+++TlPG A++++s++D++ l e I +T++G
  gi|2438043     1    -MEDALVMLKPVQNQVILKTLPGLAQSFGSILDSMQLVE-ITATVCG 45   

                   DDTiLVIcrseedakelrqelksl<-*
                   DDT+L+Ic+++e+a ++++ l ++   
  gi|2438043    46 DDTCLIICKDKETALKCFDHLCQY    69