Query sequence: gi|24380414|ref|NP_722369.1| Accession: [none] Description: hypothetical protein SMU.2079c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF965 Bacterial protein of unknown function (DUF96 181.0 6.1e-57 1 CHASE3 CHASE3 domain 12.4 0.0086 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF965 1/1 4 82 .. 1 80 [] 181.0 6.1e-57 CHASE3 1/1 44 67 .. 33 56 .. 12.4 0.0086 Alignments of top-scoring domains: DUF965: domain 1 of 1, from 4 to 82: score 181.0, E = 6.1e-57 *->tDkTmkFnfseeskkedvkeiLtaVYeaLeeKGYnPvNQIVGYlLSG tD+T++Fn+++ +k++++e+Lt+VY++LeeKGYnP+NQIVGY+LSG gi|2438041 4 TDETVRFNLDD-GNKKEISETLTHVYRSLEEKGYNPINQIVGYVLSG 49 DPaYIprhndARnlIRkleRDeivEELvksYLk<-* DPaY+pr+ndARn+IRk+eRDeivEELv++YL+ gi|2438041 50 DPAYVPRYNDARNQIRKYERDEIVEELVRYYLQ 82 CHASE3: domain 1 of 1, from 44 to 67: score 12.4, E = 0.0086 *->GYLLTgddeyLdpYeqAkpeldqa<-* GY+L+gd++y+ +Y++A++++ ++ gi|2438041 44 GYVLSGDPAYVPRYNDARNQIRKY 67