Query sequence: gi|24380412|ref|NP_722367.1| Accession: [none] Description: hypothetical protein SMU.2077c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF1292 Protein of unknown function (DUF1292) 182.3 3.7e-54 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF1292 1/1 9 98 .. 1 90 [] 182.3 3.7e-54 Alignments of top-scoring domains: DUF1292: domain 1 of 1, from 9 to 98: score 182.3, E = 3.7e-54 *->eelItLvDEnGnEtLFevLftfDikEEFgKsYVlLvPegaeeDEEge +lItLvDE+GnEtLFevL+t+D+kEEFgK+YVlLvP+gaeeD +g+ gi|2438041 9 HDLITLVDEQGNETLFEVLLTIDGKEEFGKNYVLLVPAGAEEDADGQ 55 vEvlAysftpDEDGeeGeLqliPvEtDeEWDMIEEvlNTflaE<-* +E++Aysft++EDG+eG Lq+iP+++D EW MIEEv+N+fl+E gi|2438041 56 IEIQAYSFTENEDGTEGALQPIPEDADAEWIMIEEVFNSFLDE 98