Query sequence: gi|24380376|ref|NP_722331.1| Accession: [none] Description: conserved hypothetical protein; possible bacteriocin immunity protein [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Peptidase_U61 LD-carboxypeptidase 121.2 1.8e-35 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Peptidase_U61 1/1 80 150 .. 1 74 [] 121.2 1.8e-35 Alignments of top-scoring domains: Peptidase_U61: domain 1 of 1, from 80 to 150: score 121.2, E = 1.8e-35 *->carGGyGSnrlLpyLDyedlirknPKifiGYSDITaLllaiykktGL +++GG+++n++LpyLDy li+ +PKi++GYSD+TaLl+aiy+ktG+ gi|2438037 80 STIGGFNANEILPYLDY-KLIKSHPKIICGYSDTTALLNAIYAKTGM 125 iTfHGPvlttdFgeldepddfteesfk<-* T+ GP +++ F ++e++d++ + + gi|2438037 126 ETYMGPSYSS-F-KMEEGQDYQSRMWL 150