Query sequence: gi|24380275|ref|NP_722230.1| Accession: [none] Description: hypothetical protein SMU.1925c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF177 Uncharacterized ACR, COG1399 212.6 2.6e-61 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF177 1/1 7 176 .. 1 179 [] 212.6 2.6e-61 Alignments of top-scoring domains: DUF177: domain 1 of 1, from 7 to 176: score 212.6, E = 2.6e-61 *->lakkrkdfsfdetlnlddrlqedladirdlapVsvsgrvdrydggll ++k+++++sf+e+l+ + +q++++d++ l++Vs++g+v+ yd++++ gi|2438027 7 IKKQAQGISFNEKLAIERAVQQRNPDVLALREVSAKGKVT-YDDDFY 52 vldlqvsgevtLeCsRCLepveqpldveitelfveeeaeeddkeellPdd +l++++++++tL++sR+++pveq++ +i+e+fve+++ e++ ++++ gi|2438027 53 LLNYELTYIITLPSSRSMKPVEQKKIFSINEVFVENSQLEAK-KDFM--- 98 aeddelvlvvedgeiDLeesVeDeilLalPmkplceeeckglcppcGsgr d++l+l++ed+ iDL esV+D+ilL++P+++l++ee++++++p sg+ gi|2438027 99 --DEDLFLILEDDGIDLKESVIDNILLNIPLRVLTKEEEQEQSLP--SGQ 144 cgvlleeekewpleeeeeekpnpfavLagLkk<-* +++ll+ee +++l++ ++ek++pfa+L+gL++ gi|2438027 145 NWSLLSEEQYQNLQKGKKEKSSPFAALEGLFD 176