Query sequence: gi|24380164|ref|NP_722119.1| Accession: [none] Description: hypothetical protein SMU.1800c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- CRS1_YhbY CRS1 / YhbY domain 119.9 4.2e-37 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- CRS1_YhbY 1/1 2 85 .. 1 86 [] 119.9 4.2e-37 Alignments of top-scoring domains: CRS1_YhbY: domain 1 of 1, from 2 to 85: score 119.9, E = 4.2e-37 *->LtekekryLRkkAhklkpivqiGknGvtegvieeihealkkrELvKV Lt+k++++L++ Ah+lkpivqiGknG+++ + ++++al++rEL+KV gi|2438016 2 LTSKQRAFLKSEAHSLKPIVQIGKNGLNDQIKTSVRNALDARELIKV 48 kvlg.sredrkeiaeeLeektggelVqviKskGntivLYR<-* l++++ed++e+ae+Le++ g e V i G++++LY+ gi|2438016 49 TLLQnTDEDIHEVAEILEDEIGLETVLKI---GRILILYK 85