Query sequence: gi|24380161|ref|NP_722116.1| Accession: [none] Description: hypothetical protein SMU.1797c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF143 Domain of unknown function DUF143 153.6 4.8e-43 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF143 1/1 4 105 .. 1 107 [] 153.6 4.8e-43 Alignments of top-scoring domains: DUF143: domain 1 of 1, from 4 to 105: score 153.6, E = 4.8e-43 *->ldllkviaealddkKAeDivvlDVsgisyltDyfiIatgnsnkqqvs + ll+ i++a+d+k+AeDivv D++g++ ltDyf+I ++++++q gi|2438016 4 KKLLELIVKAADEKRAEDIVVMDLQGLTTLTDYFVIMHATNSRQ-LE 49 AIadeieeelkkaGVNGgispaheEGkresdWvvlDlGdvvVHiFseeeR AIa++i+e++ ka g + +h+EG ++++Wv+lDl dvvVHiFse+eR gi|2438016 50 AIAENIREKVLKA----GGNASHIEGDSKGGWVLLDLNDVVVHIFSEDER 95 efYdLEklWg<-* +Y+LEklW gi|2438016 96 YHYNLEKLWH 105