Query sequence: gi|24380147|ref|NP_722102.1| Accession: [none] Description: hypothetical protein SMU.1781 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF402 Protein of unknown function (DUF402) 137.7 1.5e-40 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF402 1/1 37 134 .. 1 105 [] 137.7 1.5e-40 Alignments of top-scoring domains: DUF402: domain 1 of 1, from 37 to 134: score 137.7, E = 1.5e-40 *->rivvrrglaptgvydglgvrndretgdpaltffrpgkwynvtvyydn +++ +++t+v++++g+r ++t++pa+++f+++ w+n+++++++ gi|2438014 37 AVIG--VNDHTLVTESDGRR--WVTREPAIVYFHKKFWFNIIAMIRD 79 dGnslkgyYiNiatPfereeeaikyiDldlDikvhpdgeyellDedElee +G yY+N+a+P++ + ea+kyiD+dlD+kv++dge++llD+dE+e gi|2438014 80 NG---VSYYCNLASPYIMDQEALKYIDYDLDVKVFADGEKKLLDVDEYEL 126 alrdglys<-* + ++ ys gi|2438014 127 HKQKMGYS 134