Query sequence: gi|24380144|ref|NP_722099.1| Accession: [none] Description: hypothetical protein SMU.1777 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- Flavodoxin_NdrI NrdI Flavodoxin like 209.9 5.2e-60 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Flavodoxin_NdrI 1/1 7 144 .. 1 132 [] 209.9 5.2e-60 Alignments of top-scoring domains: Flavodoxin_NdrI: domain 1 of 1, from 7 to 144: score 209.9, E = 5.2e-60 *->vyysSisGNThRFVqKLglpat.qhdie.nrIpireldeele..f.V ++y+S+sGNT++FV +L+ ++++++d++ + +++++l ++ + f gi|2438014 7 LIYISLSGNTKSFVARLTNYLQsKTDLTiHSVNVKDLIKDQAdyFaL 53 dePYvLitPTYggGgngvdnGd.gaVPkqVirFLnnehNrklcrGVIgSG ++ +v+++PTY++Ggng d+Gd +++++++++F+++++N+++c G++gSG gi|2438014 54 SDYFVAFLPTYLEGGNGLDSGDiEILTTPLREFIAFADNYRYCYGIVGSG 103 NrNFGdnFclAgkiISekynVPlLykFELlGTneDVerVrk<-* N+NF++++cl++k+++e++++P+L FEL+G ++DVer+ + gi|2438014 104 NKNFNNQYCLTAKQYAEQFGFPVLDNFELRGLADDVERIGD 144