Query sequence: gi|24380143|ref|NP_722098.1| Accession: [none] Description: hypothetical protein SMU.1776c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RelB RelB antitoxin 53.0 9.8e-15 1 RHH_1 Ribbon-helix-helix protein, copG family 11.4 0.029 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- RelB 1/1 1 47 [. 1 47 [. 53.0 9.8e-15 RHH_1 1/1 3 41 .. 1 40 [] 11.4 0.029 Alignments of top-scoring domains: RelB: domain 1 of 1, from 1 to 47: score 53.0, E = 9.8e-15 *->ngsinlRIDddlKaeAtdVLekmGLTiSqairlfLtqiAktkglPFd +++i R+Dd+lK At +++GL +S+a++lfLtq kt+++PF+ gi|2438014 1 MSTIAIRVDDELKEKATELYKELGLDMSTAVKLFLTQSVKTRSIPFE 47 <-* gi|2438014 - - RHH_1: domain 1 of 1, from 3 to 41: score 11.4, E = 0.029 *->rvtirLdeellerLdelAkkrGYlSrSelireAlreyler<-* + ir+d+el+e+ +el k++G l +S +++ l + +++ gi|2438014 3 TIAIRVDDELKEKATELYKELG-LDMSTAVKLFLTQSVKT 41