Query sequence: gi|24380124|ref|NP_722079.1| Accession: [none] Description: hypothetical protein SMU.1754c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF48 Protein of unknown function DUF48 73.9 1.3e-20 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF48 1/1 8 96 .. 227 316 .. 73.9 1.3e-20 Alignments of top-scoring domains: DUF48: domain 1 of 1, from 8 to 96: score 73.9, E = 1.3e-20 *->tEIykTqLnPtISYLHEPserRfSLALDLaEiFKPiivDRvilRLik ++++ +L+ ++++ H ++ +R+SLALDL E F+ ivDR +++Li+ gi|2438012 8 SALEAVGLDSYVGFYHTDRPGRASLALDLVEEFRSYIVDRFVFSLIN 54 kgiIkkehFekdlngGAvlLneeGrkvflrafnerLektvkhr<-* kg++ k+hF+ n G v L+e Gr +f +a +r + v h+ gi|2438012 55 KGQLSKKHFDIKEN-GSVILTEKGRAIFIEAWQKRKHTEVEHP 96