Query sequence: gi|24380084|ref|NP_722039.1| Accession: [none] Description: hypothetical protein SMU.1710c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF37 Domain of unknown function DUF37 132.8 8.5e-37 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF37 1/1 1 67 [. 1 68 [] 132.8 8.5e-37 Alignments of top-scoring domains: DUF37: domain 1 of 1, from 1 to 67: score 132.8, E = 8.5e-37 *->mkkllialIklYQrlISPllppsCRFyPTCSqYAieALkkyGvlKGl mkk+lia+Ik+YQ++ISP++p+sCR+ PTCS Y+ieA++k+G lKG gi|2438008 1 MKKVLIAPIKFYQKFISPIFPASCRYRPTCSAYMIEAIEKHG-LKGF 46 wLtlkRiLRChPlhpGGvDpv<-* + + RiLRChP+ GG+Dpv gi|2438008 47 LMGIARILRCHPFVEGGEDPV 67