Query sequence: gi|24380079|ref|NP_722034.1| Accession: [none] Description: hypothetical protein SMU.1705 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF1700 Protein of unknown function (DUF1700) 26.4 1.2e-07 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF1700 1/1 1 59 [. 1 61 [. 26.4 1.2e-07 Alignments of top-scoring domains: DUF1700: domain 1 of 1, from 1 to 59: score 26.4, E = 1.2e-07 *->MnKntFLkELekaLkkLpreErddILkdYEehFyegleeGksEseIi M+ ++L++L+ +Lk+Lp + + e+F e e E ++i gi|2438007 1 MTRTEYLNQLKHYLKRLPHTDYEEAMDYFKEYFEEAGPE--NEAQVI 45 ksLgsPklIAKEll<-* + Lg+Pk A E+l gi|2438007 46 QDLGNPKEAAYEIL 59