Query sequence: gi|24380061|ref|NP_722016.1| Accession: [none] Description: hypothetical protein SMU.1683c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- HTH_11 HTH domain 74.2 9e-20 1 Rrf2 Transcriptional regulator 29.1 1.8e-08 1 HTH_DeoR DeoR-like helix-turn-helix domain 23.3 6.5e-06 1 Sigma70_ECF ECF sigma factor 14.3 0.00084 1 HTH_5 Bacterial regulatory protein, arsR family 14.1 0.0029 1 HTH_7 Helix-turn-helix domain of resolvase 11.0 0.06 1 TrmB Sugar-specific transcriptional regulator 9.3 0.073 1 MerR MerR family regulatory protein 9.7 0.095 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Rrf2 1/1 5 63 .. 12 69 .. 29.1 1.8e-08 HTH_11 1/1 5 60 .. 1 62 [] 74.2 9e-20 HTH_DeoR 1/1 5 47 .. 1 43 [. 23.3 6.5e-06 HTH_5 1/1 7 47 .. 5 45 .. 14.1 0.0029 TrmB 1/1 10 42 .. 16 48 .. 9.3 0.073 HTH_7 1/1 19 42 .. 25 48 .] 11.0 0.06 MerR 1/1 20 37 .. 1 18 [. 9.7 0.095 Sigma70_ECF 1/1 20 40 .. 179 199 .. 14.3 0.00084 Alignments of top-scoring domains: Rrf2: domain 1 of 1, from 5 to 63: score 29.1, E = 1.8e-08 *->haLlyLAlhpgegpvtseeIAerqgispvyLrkilakLrkaGL.VkS + L+ L+l++++ +t++e+Ae + +s++ + + l L +aG+++ S gi|2438006 5 RLLAILSLLSDRNRITAKELAEKFEVSKRTIYRDLESLNQAGIpIVS 51 vRGpgGGYrLAr<-* G+ GG +L + gi|2438006 52 YAGRDGGLSLMK 63 HTH_11: domain 1 of 1, from 5 to 60: score 74.2, E = 9e-20 *->RllqiLelLlqarepfvsgqeLAerLgVSRrTirrDIkaLealGeey Rll+iL lL + r++ ++++eLAe+++VS rTi+rD+++L+++G gi|2438006 5 RLLAILSLL-SDRNR-ITAKELAEKFEVSKRTIYRDLESLNQAG--- 46 GvpIesepgrgGGYr<-* +pI+s +gr+GG gi|2438006 47 -IPIVSYAGRDGGLS 60 HTH_DeoR: domain 1 of 1, from 5 to 47: score 23.3, E = 6.5e-06 *->RieqIlelLkqqGtlsveeLvelldVSeaTiRRDLneLeeqGl<-* R+ +Il lL ++ ++ +eL+e + VS+ Ti RDL L +G+ gi|2438006 5 RLLAILSLLSDRNRITAKELAEKFEVSKRTIYRDLESLNQAGI 47 HTH_5: domain 1 of 1, from 7 to 47: score 14.1, E = 0.0029 *->lkILylLseegelcvceLaeilglSqstvShHLkkLreaGL<-* l IL+lLs+++ ++ eLae +++S+ t+ + L L +aG+ gi|2438006 7 LAILSLLSDRNRITAKELAEKFEVSKRTIYRDLESLNQAGI 47 TrmB: domain 1 of 1, from 10 to 42: score 9.3, E = 0.073 *->laLLEklGpatareiaeesgvPrskvYevLrsL<-* l LL+ + + ta+e+ae+ +v++ ++Y+ L+sL gi|2438006 10 LSLLSDRNRITAKELAEKFEVSKRTIYRDLESL 42 HTH_7: domain 1 of 1, from 19 to 42: score 11.0, E = 0.06 *->isikqIAkefniSRsTvYRylaas<-* i++k++A+ f +S+ T+YR l+++ gi|2438006 19 ITAKELAEKFEVSKRTIYRDLESL 42 MerR: domain 1 of 1, from 20 to 37: score 9.7, E = 0.095 *->tIgevAellGvsprtLRy<-* t +e+Ae++ vs rt+++ gi|2438006 20 TAKELAEKFEVSKRTIYR 37 Sigma70_ECF: domain 1 of 1, from 20 to 40: score 14.3, E = 0.00084 *->sveEiAekLgvSkRTveRnWa<-* + +E+Aek++vSkRT++R+++ gi|2438006 20 TAKELAEKFEVSKRTIYRDLE 40