Query sequence: gi|24380037|ref|NP_721992.1| Accession: [none] Description: hypothetical protein SMU.1659c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylas 131.1 4.9e-38 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TP_methylase 1/1 15 215 .. 1 219 [] 131.1 4.9e-38 Alignments of top-scoring domains: TP_methylase: domain 1 of 1, from 15 to 215: score 131.1, E = 4.9e-38 *->kLylVGaGPGdpellTlrAleaLqqADvvyydklvnpdiLelaplla kLylV++++G+ +++T+r + +L+++D + +++d++ + +ll+ gi|2438003 15 KLYLVPTPIGNLQDMTFRSIAILKKVDYI-----AAEDTRNTGLLLK 56 vliivgkrvgkhdrkqeeinellveeaaaGrkdVvrLkgGDPfvfGrgge ++ i + + h+++ e l+++++ G + ++++G P+++++g++ gi|2438003 57 HFDISTRQLSFHEHNAFEKIPDLLKLLKSGNSLAQVSDAGLPSISDPGYD 106 llerlveagipvevvPGitAalaaaaaaGiplthgrqvassltlttghlr l++++ ++ i v +PG++A+++a++a+G+ +++ ++++l++++g+ + gi|2438003 107 LVRAAIQEDIAVIALPGASAGITALIASGLAPQP-HIFYGFLPRKSGQQK 155 dakvpdslnlealaeggeTLvfymavhrlregqLiaeeLaahgksadtpV + +e + +eT +fy+++ r +e ++e+++++++ d+++ gi|2438003 156 SF-------FEEKKYYPETQIFYESPYRVQE---TLENILSVYG--DRQI 193 aivenatkpdervirgtLgeid<-* ++ +++tk +e+ rg+ +ei gi|2438003 194 VLTRELTKLYEEYQRGNISEIL 215