Query sequence: gi|24380001|ref|NP_721956.1| Accession: [none] Description: hypothetical protein SMU.1621c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF1250 Protein of unknown function (DUF1250) 130.6 1.9e-36 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF1250 1/1 4 69 .. 1 67 [] 130.6 1.9e-36 Alignments of top-scoring domains: DUF1250: domain 1 of 1, from 4 to 69: score 130.6, E = 1.9e-36 *->SFYhFLMtfrgPkdkdplgeLAnwifeDhsFPKqskdydeISsYLre SFY++LMt+r+Pk++dp+++LA+++feD++FPK++++++ +S+YL e gi|2438000 4 SFYTWLMTQRHPKSHDPVAILADLVFEDTTFPKHTDSFERVSRYL-E 49 lnapflfnmevFDrawslYl<-* ++a+f+fn++ FDr+w++Yl gi|2438000 50 DEASFSFNLSEFDRIWEDYL 69