Query sequence: gi|24379996|ref|NP_721951.1| Accession: [none] Description: hypothetical protein SMU.1616c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- NUDIX NUDIX domain 68.7 2.2e-20 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- NUDIX 1/1 17 133 .. 1 114 [. 68.7 2.2e-20 Alignments of top-scoring domains: NUDIX: domain 1 of 1, from 17 to 133: score 68.7, E = 2.2e-20 *->rrravgvvllnedgevLLvrrsrpppglWelPGGgvepGEspeeAAv + +g++l ++dg+vLL+ r ++ +W++PGG +e GEs ++A gi|2437999 17 ILTFAGGILADKDGRVLLQLRGDK--KTWAIPGGAMELGESTLDTAK 61 REleEEtGlrvedsvvllvlllgvleypap.rd.......vvhvflael. RE++EEtG++v + v++l v+ + ++++ +++v ++ + + gi|2437999 62 REFFEETGIKV-----EAVCFLNVYSHFEEvYPngdevqtIVMIYEFKAl 106 gge.epqpdpgEvaevrWvpleellal<-* + + + + +E+ ++r+++ ee+ +l gi|2437999 107 NDFdISDFHNEETLRLRFFSEEEIAKL 133