Query sequence: gi|24379985|ref|NP_721940.1| Accession: [none] Description: hypothetical protein SMU.1604c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PadR Transcriptional regulator PadR-like family 52.7 4.6e-15 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PadR 1/1 6 82 .. 10 89 .] 52.7 4.6e-15 Alignments of top-scoring domains: PadR: domain 1 of 1, from 6 to 82: score 52.7, E = 4.6e-15 *->lvLalLAeenqPlyGYeiikeLeelsgGffrpseGtLYPiLkrLEke ++L++L + +++ GYei + L++ + f++ +G +YP+L++LEk+ gi|2437998 6 IILGIL-SK-KERSGYEINDILQNQLSYFYDGTYGMIYPTLRKLEKD 50 GLveseweesdggGppRKyYrLTdaGrreLaer<-* G +++e + + g+p++++Y++T+ G++eLa gi|2437998 51 GKITKEVVIQ-DGRPNKNIYAITESGKKELASY 82