Query sequence: gi|24379945|ref|NP_721900.1| Accession: [none] Description: hypothetical protein SMU.1560 [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DUF6 Integral membrane protein DUF6 86.0 1e-22 1 Multi_Drug_Res Small Multidrug Resistance protein 9.6 0.058 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- DUF6 1/1 11 137 .] 1 128 [] 86.0 1e-22 Multi_Drug_Res 1/1 102 128 .. 72 98 .] 9.6 0.058 Alignments of top-scoring domains: DUF6: domain 1 of 1, from 11 to 137: score 86.0, E = 1e-22 *->fiWalytvfskkllerispltltawrfliagilllilllfllkgppl +++al+++++k+++e++++ +ta+r l+ + +l+ ++fl+kg+ gi|2437994 11 LFAALTSILAKIGIEDVNSNLATAIRTLVVL-FLAWGMVFLTKGQTG 56 lallslk.ilallylgilgtalgyllyfyalkyvsaskasvltslsPvft l +s+k++ +l+++g+ t+ +l+y+ al+ + as+++++ ls v+t gi|2437994 57 LTDISKKsWTFLILSGLA-TGASWLCYYRALQLGKASEVVPIDKLSVVIT 105 lilsvllLgEkltlkqllGivlillGvllisl<-* lil++l+L+E +++k l+G +li +G+l+i+ gi|2437994 106 LILAFLVLHEDFSIKSLIGCILIGGGTLMIVS 137 Multi_Drug_Res: domain 1 of 1, from 102 to 128: score 9.6, E = 0.058 *->tvlttlvgillFgEslslkkiiglaLI<-* +v+t + ++l ++E++s+k +ig LI gi|2437994 102 VVITLILAFLVLHEDFSIKSLIGCILI 128