Query sequence: gi|24379943|ref|NP_721898.1| Accession: [none] Description: hypothetical protein SMU.1557c [Streptococcus mutans UA159] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- DRTGG DRTGG domain 179.5 6.3e-56 1 CBS CBS domain pair 67.0 9.3e-18 1 4HBT Thioesterase superfamily 16.0 0.00092 1 GntR Bacterial regulatory proteins, gntR family 14.4 0.0014 1 HTH_11 HTH domain 11.3 0.033 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HTH_11 1/1 3 58 .. 1 62 [] 11.3 0.033 GntR 1/1 14 57 .. 18 62 .. 14.4 0.0014 DRTGG 1/1 75 177 .. 1 115 [] 179.5 6.3e-56 CBS 1/1 202 306 .. 9 114 .] 67.0 9.3e-18 4HBT 1/1 343 419 .. 1 74 [] 16.0 0.00092 Alignments of top-scoring domains: HTH_11: domain 1 of 1, from 3 to 58: score 11.3, E = 0.033 *->RllqiLel...LlqarepfvsgqeLAerLgVSRrTirrDIkaLealG + ++iLe ++L ++ vs ++ +L VS T +r Ik+ e G gi|2437994 3 KHQDILEYlenL-TVGKR-VSVRSISNHLKVSDGTAYRAIKEAENRG 47 eeyGvpIesepgrgGGYr<-* ++e +p+ G + gi|2437994 48 -----IVETRPRS--GTI 58 GntR: domain 1 of 1, from 14 to 57: score 14.4, E = 0.0014 *->lrpGdkLPsEreLaaefgVSRttvReALrrLeaeGlverrqgrGt<- l+ G + s+r++ + VS t +A+++ e G+ve r+++Gt gi|2437994 14 LTVGKRV-SVRSISNHLKVSDGTAYRAIKEAENRGIVETRPRSGT 57 * gi|2437994 - - DRTGG: domain 1 of 1, from 75 to 177: score 179.5, E = 6.3e-56 *->eianiLdAeVlnggdgldrrvskfvIgAMslenmleylrpkGsLvIt eiani ++eV++g+ gl +++skf+IgAM+++n+ +yl+ ++L+I+ gi|2437994 75 EIANISESEVVSGESGLGHEFSKFSIGAMTIDNVHRYLTN-DGLLIV 120 pGDReDiqlaAleagaagGvpiaglLlTGGfdpspeIlkLAeeAlelglP GDReDiql+Ale+++a +L+TGGf +s+++l+ + lg+P gi|2437994 121 -GDREDIQLLALENKNA-------ILVTGGFSVSEKVLDTSNL---LGIP 159 VlstsyDTFttAsrinsa<-* V++t+yDTFt+A++in+a gi|2437994 160 VMVTNYDTFTVATIINQA 177 CBS: domain 1 of 1, from 202 to 306: score 67.0, E = 9.3e-18 RF xxxxxxxxx xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx *->tvdpedttl.ealklmrengisrlPVvdedgklvGivterDlllral +++ +++t+++ l++++++ r+P++++++ +vG++++rD + gi|2437994 202 FLH-DTDTVrDYNSLIKKTNHVRYPIINSHDMVVGVISMRD-VAGKD 246 RF xxxxxxxxxxxxxxxxxxxxx xxxxxxxxxxxxxxxxxxxxxxxxxx ..tpvsdiMtrpPvitvppdtsl.ealelmlehgirhrrlpVvDedgklv +++ + ++Mtr+P ++++++ sl + ++m+ +g + lpVv ed l+ gi|2437994 247 pnMVLNQLMTRNP-VVAKSNLSLaNISQKMIFEGFD-M-LPVVKEDYSLL 293 RF xxxxxxxxxxxxx GivtreDilrala<-* G++tr+ +++ l+ gi|2437994 294 GVITRRQVMENLQ 306 4HBT: domain 1 of 1, from 343 to 419: score 16.0, E = 0.00092 *->gGvvhGGvylalaDeaagaaarslg...vvvvelnidFlrPvrlGdv G++ +Gv+ +++ + + ++ ++++ + ++ + Fl +v ++d gi|2437994 343 AGNLAHGVLTEFIKDITMRVLTQKHkknIIIEQMMLYFLQAVQIDDL 389 ltvearvvrlGrtsavvevevrredgrlla<-* l ++ +++ r+sa+ + e++ ++++ + gi|2437994 390 LKIHPKIITENRRSATLDFEIYHGSQVITK 419